FASTF/TFASTFv3(1) FASTF/TFASTFv3(1)NAME
fastf3, fastf3_t - compare a mixed peptide sequence against a protein
database using a modified fasta algorithm.
tfastf3, tfastf3_t - compare a mixed pepide sequence against a trans‐
lated DNA database.
DESCRIPTIONfastf3 and tfastf3 are designed to compare a sequence of mixed peptides
to a protein (fastf3) or translated DNA (tfastf3) database. Unlike the
traditional fasta3 search, which uses a protein or DNA sequence, fastf3
and tfastf3 work with a query sequence of the form:
>testf from mgstm1
MGCEN,
MIDYP,
MLLAY,
MLLGY
This sequence indicates that a mixture of four peptides has been found, with
'M' in the first position of each one (as from a CNBr cleavage), in the second
position 'G', 'I', or 'L' (twice), at the third position 'C', 'D', or 'L'
(twice), at the fourth position 'E', (included with the distribution), the
mixture is deconvolved to form:
testf MILGY-----------MLLEY-----------MGDAP-----------
::::: ::::: :::::
GT8.7 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEK
10 20 30 40 50
testf --------------------------------------------------
GT8.7 FKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIV
60 70 80 90 100
20
testf ------------MLCYN
:::::
GT8.7 ENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAG
110 120 130 140 150
Optionsfastf3 and tfastf3 can accept a query sequence from the unix "stdin"
data stream. This makes it much easier to use fasta3 and its relatives
as part of a WWW page. To indicate that stdin is to be used, use "-" or
"@" as the query sequence file name.
-b # number of best scores to show (must be < -E cutoff)
-d # number of best alignments to show ( must be < -E cutoff)
-D turn on debugging mode. Enables checks on sequence alphabet
that cause problems with tfastx3, tfasty3, tfasta3.
-E # Expectation value limit for displaying scores and alignments.
Expectation values for fastf3 and tfastf3 are not as accurate as
those for the other fasta3 programs.
-H turn off histogram display
-i compare against only the reverse complement of the library
sequence.
-L report long sequence description in alignments
-m 0,1,2,3,4,5,6,10
alignment display options
-n force query to nucleotide sequence
-N # break long library sequences into blocks of # residues. Useful
for bacterial genomes, which have only one sequence entry. -N
2000 works well for well for bacterial genomes.
-O file
send output to file
-q/-Q quiet option; do not prompt for input
-R file
save all scores to statistics file
-S # offset substitution matrix values by a constant #
-s name
specify substitution matrix. BLOSUM50 is used by default;
PAM250, PAM120, and BLOSUM62 can be specified by setting -s
P120, P250, or BL62. With this version, many more scoring
matrices are available, including BLOSUM80 (BL80), and MDM_10,
MDM_20, MDM_40 (M10, M20, M40). Alternatively, BLASTP1.4 format
scoring matrix files can be specified.
-T # (threaded, parallel only) number of threads or workers to use
(set by default to 4 at compile time).
-t # Translation table - tfastf3 can use the BLAST tranlation tables.
See http://www.ncbi.nih.gov/htbin-post/Taxon‐
omy/wprintgc?mode=c/.
-w # line width for similarity score, sequence alignment, output.
-x "#,#"
offsets query, library sequence for numbering alignments
-z # Specify statistical calculation. Default is -z 1, which uses
regression against the length of the library sequence. -z 0 dis‐
ables statistics. -z 2 uses the ln() length correction. -z 3
uses Altschul and Gish's statistical estimates for specific pro‐
tein BLOSUM scoring matrices and gap penalties. -z 4: an alter‐
nate regression method.
-Z db_size
Set the apparent database size used for expectation value calcu‐
lations.
-1 Sort by "init1" score.
-3 (TFASTF3 only) use only forward frame translations
Environment variables:
FASTLIBS
location of library choice file (-l FASTLIBS)
SMATRIX
default scoring matrix (-s SMATRIX)
SRCH_URL
the format string used to define the option to re-search the
database.
REF_URL
the format string used to define the option to lookup the
library sequence in entrez, or some other database.
AUTHOR
Bill Pearson
wrp@virginia.EDU
local FASTF/TFASTFv3(1)